<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27674
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MNTPLDELQWKSPEWIQAFGLGTENVLDYFSESPFFDKTSNNHVIKMQRQFSQLPPAPNGGETNGNTDPQRDANGNFIPIGASTNIDGSSSSNLTTFKYVDPIRRAILNRYPLHAMLETELMKLKGIEYVLADVSEPDFWLIRKQRRYSREQIEILQDYYIIGANVYQSPTVFNIVQSRLMSTSLHLSKTLEQIYKLTQFEPSQGVRFINPPIPASLSSNVSTGTNPLSGPPSTVNPMNNGHTISNNNPRSVGPQMTANTVTGGQTAVSMASTSQFDNSNNPKSINESMTKEVMNKLIVTSIRSSPEYI |
Length | 309 |
Position | Head |
Organism | Naumovozyma dairenensis (strain ATCC 10597 / BCRC 20456 / CBS 421 / NBRC 0211 / NRRL Y-12639) (Saccharomyces dairenensis) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Naumovozyma.
|
Aromaticity | 0.08 |
Grand average of hydropathy | -0.503 |
Instability index | 48.16 |
Isoelectric point | 6.12 |
Molecular weight | 34415.22 |
Publications | PubMed=22123960
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 PIRNR:PIRNR013286
|
GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coactivator activity GO:0003713 IEA:EnsemblFungi
|
GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
RNA polymerase II preinitiation complex assembly GO:0051123 IEA:EnsemblFungi
|
Interaction
Repeat regions
Repeats |
>MDP27674
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.98| 18| 20| 226| 243| 1
---------------------------------------------------------------------------
226- 243 (37.12/20.49) NPLS.GPPSTVNPMNNGHT
248- 266 (30.86/15.92) NPRSvGPQMTANTVTGGQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.77| 15| 18| 58| 74| 2
---------------------------------------------------------------------------
58- 74 (24.17/17.84) PNGGETngNTDPQRDAN
79- 93 (26.59/13.13) PIGAST..NIDGSSSSN
---------------------------------------------------------------------------
|