<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27650
| Description |
Mediator of RNA polymerase II transcription subunit 8 |
| Sequence | MSQSPENIVPNPSDEALQNTVKDNFNDIPTQALDAVRMRLAQLTHSLRRIRDELSRAELPQWYSLQSQINVTLSQLMSVTTTLQHFQETLDSTVVYPLPKFPTTSHENLLTTLLRKKNAPEVDDWISDARETLGIDLSTIDPKQLEKTLQNDKDITKWALGIFTTEFEKHNFKDLENEDELNLSSKNNYKPSKPFSVESILNFTYRGELALSSTQEEV |
| Length | 218 |
| Position | Head |
| Organism | Naumovozyma castellii (strain ATCC 76901 / CBS 4309 / NBRC 1992 / NRRL Y-12630) (Yeast) (Saccharomyces castellii) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Saccharomycotina> Saccharomycetes>
Saccharomycetales> Saccharomycetaceae> Naumovozyma.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.637 |
| Instability index | 46.37 |
| Isoelectric point | 4.85 |
| Molecular weight | 24980.63 |
| Publications | PubMed=22123960
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364144
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | protein-macromolecule adaptor activity GO:0030674 IEA:EnsemblFungi
RNA polymerase II cis-regulatory region sequence-specific DNA binding GO:0000978 IEA:EnsemblFungi
TBP-class protein binding GO:0017025 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP27650
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.32| 13| 30| 117| 135| 1
---------------------------------------------------------------------------
117- 135 (18.21/23.74) KNAPEVDDWisdareTLGI
150- 162 (24.11/14.58) QNDKDITKW......ALGI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.77| 23| 30| 21| 43| 3
---------------------------------------------------------------------------
21- 43 (38.21/25.80) VKDNFN..DIPT.QALDA.VRMRLAQL
50- 76 (23.56/13.38) IRDELSraELPQwYSLQSqINVTLSQL
---------------------------------------------------------------------------
|