<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27640
Description |
Mediator of RNA polymerase II transcription subunit 6 |
Sequence | MADPSSSTSAMPLDEIQWHTNPAVVGGSIHDNSVLFYFRESPFYDKTSNNEVLYQQGLHNQTMMQFLETRERFERRLREMSGLEFVVAQEPAETAPGTGTGVWVINKQTRRKRQGEEDEISVHGTYFLVGENVYMAPTLADIISMRLASASSSISRLLPIAASVQSWSPGTGRVYKTPSMTSQTNQANQPSSQTQSQPTSQPATTTTTTALPPPDPRWLEETLMIHETFGDHHLDKNPITGKPGDFHLSSTGRKIQTLPTAAAGNKKPGSGLPPLPAINTKVQQNPMGSGKQVTGKETKSPKTPSSSTGPGTGGMSTGMGKPKKRKSSKAAVTPTS |
Length | 336 |
Position | Head |
Organism | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Chaetomium.
|
Aromaticity | 0.06 |
Grand average of hydropathy | -0.668 |
Instability index | 52.96 |
Isoelectric point | 9.39 |
Molecular weight | 36311.30 |
Publications | PubMed=21784248
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27640
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 64.60| 14| 16| 258| 271| 1
---------------------------------------------------------------------------
158- 172 (21.30/10.17) LPI.AASVQSwSP.GTG
258- 271 (25.69/13.67) LPT.AAAGNK.KP.GSG
275- 290 (17.61/ 7.22) LPAiNTKVQQ.NPmGSG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 119.68| 35| 211| 78| 112| 2
---------------------------------------------------------------------------
78- 112 (61.43/27.93) REMSGLEFVVAQEP.AETAPGTGTGVWVINKQTRRK
291- 326 (58.25/26.14) KQVTGKETKSPKTPsSSTGPGTGGMSTGMGKPKKRK
---------------------------------------------------------------------------
|