<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27638

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMALLMEGGDPMSVDGSSTMPAHMRVMPDMGITGAPMTLDDVDLFGDAVMNNALDALPPAPGHPPPSRALQRRIAELRARGCCQGIAWSRQGTIASISADGMSIELRFLRTNPENGDWELTDAALSLSVALVPASSPSATSSSGSGTSNTTVISAGAPFVHLAWAPSVHTSSFELAAIDALGRITIFLFTQNINKPYLSRKWDTDPVDDLHAVVGCYWLPLPFNVSYVANWVQTDYRYEPILSPAWGPIHPNHTKSALVCVTTNGLLKMLFPQNNNRIEETSIELESVTASDDLITHAAIGADRNTLLIALAMGSKQLRVVRVGIQWGLPQVDKQQMPPSVPLRPSLRESRVAVTTLLDPEQQQSDGDAPIAQLTHLEILPSPLGETPQTVLPPVILAVRSYLPQEGSLYAAHQEPFTVIDRWELFTDQPKAFHPAFEQLGAKNSASSQPSAMQTLRKLDPVVIPGKVVVTVNTLQFGRVVCFGFSDGTLQYRDRFTMNEVYTEQATTNITSPLQVGFQWETEGPCLQMAFAPTNCSFVQVSEDGSVKWVKLRYPVDDPNMTLQGPKLKAVAASLAVASVGANIAGPNIHNHCDDVMAIARPLAKKFKDFPTAWVREFVTMFKITVDYSEEAHHDQLMRNSLLQFCLSILNHFGFNGDFQPRTFSGKFANLALAVRNIVVLITIASNAPNTIKEKLSPLDEPEVVDALASCAKWGFDLLAWLTDRLLALSTDQTIKAMLADQKRFPDLARYLHSKNDVSLHLLLCSSTRGLLSAVCRRLQVVESLAHRATVYYESRYAVDPAAAAQKTLPPLYHAYVKMQRVVTASLVKASDFDKLLTALSRDIQTAYIQTFSGVATQIRQHASGSGGQPLTEQQQQQCNEQFIKKAQSHVELDMLLGQNPPPGFREVLACFFGNIFPAFRATVDPRSVFFADWSLLEEIVAEDERTLKRRREGGGRYVDVFKRVELCGRGQVLPRGRIVASVKTERAEAVPMVPSQSQSSHQAASQAQGQQSQQQQGATPAPNATPSVPISQLNPPTGPTQPPNSSGNTANANPNTGTNANTLGGSVPGLQGFVPVTANLAVNASQWRRCVRCAAVMEDVWGQRPGFTFVLTQQRRCACGGGWGLVPRGD
Length1130
PositionTail
OrganismChaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Chaetomiaceae> Chaetomium.
Aromaticity0.07
Grand average of hydropathy-0.141
Instability index46.70
Isoelectric point6.47
Molecular weight123162.88
Publications
PubMed=21784248

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364149
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27638
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      64.50|      19|      27|      10|      35|       1
---------------------------------------------------------------------------
   10-   28 (35.61/16.54)	PMSVD.....GSSTMPAHMRVMPD
   35-   58 (28.89/ 8.62)	PMTLDdvdlfGDAVMNNALDALPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      83.94|      26|      27|     178|     204|       2
---------------------------------------------------------------------------
  178-  204 (42.25/30.83)	DALGRIT.IFLFTQNINKPYLSrKW.DTD
  207-  234 (41.69/25.45)	DDLHAVVgCYWLPLPFNVSYVA.NWvQTD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      45.88|      13|      27|    1034|    1060|       3
---------------------------------------------------------------------------
 1017- 1029 (24.89/12.27)	GATPAPNATPSV....P
 1038- 1054 (20.99/19.90)	GPTQPPNSSGNTananP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.31|      13|      19|      66|      80|       4
---------------------------------------------------------------------------
   66-   80 (18.31/18.01)	SRalQRRIAELRARG
   88-  100 (23.00/14.92)	SR..QGTIASISADG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      81.65|      25|      26|     317|     342|       7
---------------------------------------------------------------------------
  317-  342 (39.73/24.57)	LRVVRVGIQwGLPQVDKQQMPPSVPL
  346-  370 (41.91/20.64)	LRESRVAVT.TLLDPEQQQSDGDAPI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.45|      21|      26|     555|     575|       8
---------------------------------------------------------------------------
  547-  567 (36.91/21.58)	KWVKLRYPVDDPNMTLQGPKL
  568-  588 (32.55/18.12)	KAVAASLAVASVGANIAGPNI
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      37.11|      10|      26|     133|     142|       9
---------------------------------------------------------------------------
  133-  142 (17.16/ 7.82)	ASSPSATSSS
  162-  171 (19.95/10.24)	AWAPSVHTSS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      39.09|      11|      26|     660|     670|      10
---------------------------------------------------------------------------
  660-  670 (19.95/14.17)	PRTFSGKFANL
  688-  698 (19.14/13.26)	PNTIKEKLSPL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     139.72|      44|     134|     752|     799|      11
---------------------------------------------------------------------------
  752-  799 (66.68/54.53)	HSKNDVSLHLLLCSST....RGLLSavCRRLQVVEslAHRATVYYESRYAVD
  885-  932 (73.04/47.43)	KAQSHVELDMLLGQNPppgfREVLA..CFFGNIFP..AFRATVDPRSVFFAD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      34.07|      11|      22|     955|     965|      14
---------------------------------------------------------------------------
  955-  965 (20.31/14.38)	GRYVDVFK..RVE
  976-  988 (13.75/ 7.44)	GRIVASVKteRAE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      40.34|      12|      21|     453|     465|      16
---------------------------------------------------------------------------
  453-  465 (17.18/15.93)	QTLrKLDPVVIPG
  472-  483 (23.16/15.61)	NTL.QFGRVVCFG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27638 with Med16 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KTERAEAVPMVPSQSQSSHQAASQAQGQQSQQQQGATPAPNATPSVPISQLNPPTGPTQPPNSSGNTANANPNTGTNANTLGGSVPGL
983
1070










Molecular Recognition Features






MoRF SequenceStartStop




NANANA