<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27634
| Description |
Uncharacterized protein |
| Sequence | MENLWRAPPLSQQRSAAGFRGTTGAKPATYGADSHLPWPVPGLRSSVTTTGSSTAVAGQMHQLHAAASAAAGFSFMPFFAAGFGTDSEVITAGGMSQGGRRNRADAFQSRPYPDRRPMGYQSKVRVTDKYKVIGFISSGTYGRVYKALGRQGQPGEFAIKKFKPDKEGEQATYTGISQSAIREMALCSELSHPNIIKLIEIILEDKCIFMVFEYAEHDLLQIIHHHTQQPRHPIPPSTIKSIMFQLLNGCQYLHSNWVLHRDLKPANIMVTSAGEVKIGDLGLARLSYKPLHSLYSGDKVVVTIWYRAPELLLGSRHYTPAIDMWAVGCIFAELLSLRPIFKGEEAKMDSKKTVPFQRNQMQKIVDIMGLPTKERWPLLTSTPEYSQLATLTPPVSHSHHHHHHHSHHYNSQQQRNLGSTSHLEKWYYTTISPPSHSQGPSPLSSLGAEGYSLLSGLLEYDPEKRLTATQALQHPFFSTGDPVNATNCFEGSKTEYPVRRVSQDDSLSGLGGGDRSGGLTGVKRSLGGEAGGGGGKRVKEG |
| Length | 541 |
| Position | Kinase |
| Organism | Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Chaetomiaceae> Chaetomium.
|
| Aromaticity | 0.09 |
| Grand average of hydropathy | -0.430 |
| Instability index | 47.89 |
| Isoelectric point | 9.28 |
| Molecular weight | 59397.64 |
| Publications | PubMed=21784248
|
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | ATP binding GO:0005524 IEA:InterPro
protein kinase activity GO:0004672 IEA:InterPro
|
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27634
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 70.19| 21| 48| 99| 121| 2
---------------------------------------------------------------------------
99- 121 (35.51/26.67) GRRNRADAFQSRPY.PDRRpmGYQ
149- 170 (34.68/18.90) GRQGQPGEFAIKKFkPDKE..GEQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.28| 18| 52| 16| 34| 3
---------------------------------------------------------------------------
21- 73 (15.38/ 6.80) GTTGAKPATYGADShlpwpvpglrssvtttgsstavagqmhqlhaaasaAAGF
74- 95 (28.90/12.83) SFMPFFAAGFGTDS...............................evitAGGM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.60| 11| 16| 506| 518| 4
---------------------------------------------------------------------------
506- 518 (17.15/12.69) SLSGLGGGdrSGG
525- 535 (22.45/10.11) SLGGEAGG..GGG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 51.99| 12| 47| 286| 299| 6
---------------------------------------------------------------------------
286- 299 (16.37/14.73) LSYK.PlhSLYSGDK
304- 316 (17.34/ 7.95) IWYRaP..ELLLGSR
335- 345 (18.28/ 8.77) LSLR.P...IFKGEE
---------------------------------------------------------------------------
|