<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27605
| Description |
Predicted protein |
| Sequence | MGDRLTQLQDAVDQFAQQLVACMHFVQMRHDLEKLGPNDKIREPKEQAAKEVDALPPQDFRAGLVELSRDLIVKEQQIEVLISTLPGLDNSEQDQERHIRDLEEDLKTAEAQRVEALREKELILTQLDAIIRNVRRP |
| Length | 137 |
| Position | Middle |
| Organism | Hypocrea jecorina (strain QM6a) (Trichoderma reesei) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Hypocreomycetidae> Hypocreales> Hypocreaceae> Trichoderma.
|
| Aromaticity | 0.02 |
| Grand average of hydropathy | -0.629 |
| Instability index | 57.32 |
| Isoelectric point | 4.84 |
| Molecular weight | 15800.76 |
| Publications | PubMed=18454138
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IEA:EnsemblFungi
mediator complex GO:0016592 IEA:UniProtKB-UniRule
|
| GO - Biological Function | RNA polymerase II repressing transcription factor binding GO:0001103 IEA:EnsemblFungi
transcription coactivator activity GO:0003713 IEA:EnsemblFungi
transcription corepressor activity GO:0003714 IEA:EnsemblFungi
|
| GO - Biological Process | negative regulation of transcription by RNA polymerase II GO:0000122 IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II GO:0045944 IEA:EnsemblFungi
|
Interaction
Repeat regions
| Repeats |
>MDP27605
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 83.62| 28| 33| 47| 79| 1
---------------------------------------------------------------------------
52- 79 (46.87/27.06) VDALP.....PQDFRAGLVELSRDLIVKE.QQIE
82- 115 (36.75/12.92) ISTLPgldnsEQDQERHIRDLEEDLKTAEaQRVE
---------------------------------------------------------------------------
|