<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27589
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | METAESEKTRFEVECEFVQALANPNYLNFLAQRGYFKEEYFVNYLRYLLYWKQPQYARCLKFPQCLHMLEALQSQQFRDAMAYGPSAKYVEDQVVLQWQFYLRKRNRLFMIPGEEGQDLEESDEDADNKQKDTDDEEDEDMVKAADTEAAESDTTSTK |
Length | 158 |
Position | Middle |
Organism | Caenorhabditis brenneri (Nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
Aromaticity | 0.13 |
Grand average of hydropathy | -0.885 |
Instability index | 52.63 |
Isoelectric point | 4.44 |
Molecular weight | 18739.54 |
Publications | |
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27589
No repeats found
|