<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27586
| Description |
Uncharacterized protein |
| Sequence | MSGPDAKSFVMSFAAQIEECHLTEAFEKFNHQKTSTEQLIMELIDRITASVDFVLTPPSFVAKDWKMAELAPGAQTLYLACIELMASPHSPETLVSAMINVMQMKPHLRPFNVINCIALILTALPSSYSEALHNELVAVFDNGDTAKLKFEELVFDIYEENLLLNIPSRVKSLNVISQFYFIHCNMTHQPVESTSSMPSASSASAISQQLQPQHPHQLQQQQSHLNLQQQLQELPPLPPMQQVPQQQPLQHHPHHPHHPMDTTQQPSQPQQPPQTPQHRMAPPTPMVPAAPPPSSAQMAAAAAAQQQQQQHQMAAAAMHQQMTPQYPAPMFHHQSPAHHMPYGMTPHMQQAMQQHAAHQQMVQGQMHMNPMMHNMTPQQQQQQYAYMQFLHQQQQQHQQQQQQQQPPHM |
| Length | 409 |
| Position | Tail |
| Organism | Caenorhabditis brenneri (Nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.579 |
| Instability index | 81.17 |
| Isoelectric point | 6.19 |
| Molecular weight | 46353.33 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27586
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 99.32| 18| 19| 231| 248| 1
---------------------------------------------------------------------------
236- 253 (37.83/10.68) PLPPMQQVPQQQPLQHHP
256- 272 (29.73/ 6.39) PHHPMDTTQQPSQPQQ.P
389- 406 (31.75/ 7.46) FLHQQQQQHQQQQQQQQP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 53.54| 14| 70| 298| 311| 3
---------------------------------------------------------------------------
298- 311 (26.77/ 8.14) MAAAAAAQQQQQQH
371- 384 (26.77/ 8.14) MMHNMTPQQQQQQY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 46.34| 14| 20| 75| 91| 6
---------------------------------------------------------------------------
72- 85 (26.02/ 9.78) P.GAQTLYLACIELM
88- 102 (20.32/16.70) PhSPETLVSAMINVM
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.85| 16| 20| 197| 212| 7
---------------------------------------------------------------------------
197- 212 (27.68/11.38) MPSASSASAISQQLQP
218- 233 (25.17/ 9.68) LQQQQSHLNLQQQLQE
---------------------------------------------------------------------------
|