<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27584
| Description |
Uncharacterized protein |
| Sequence | MTALEQTQALCVQVDDICQNGMESAEDCIKLLDELAKIPMSVEIIQKTNIGIKVNTMRKKVSDEAIAKRAKNIIKEWKNIVDGKGKSQDDGDAPPPAKKQRKESVEAPKPEKKKLEAPFKRPEPSNRPEIVAQFASAAFPPKHLENDETRLKSAQLLLSALRSGEMPQGTLDPEELAVQIEEKLHSVHRGTNKNYSAAVRSRIFNLRDKKNLALRENVLTGVVRAEKFATMTSEEMASPEIRNMRDKFTKEAILEHQMSVQQGTPSDMFKCGKCGKKNCTYTQLQTRSSDEPMTTFVFCLECGNRWKFC |
| Length | 309 |
| Position | Unknown |
| Organism | Caenorhabditis brenneri (Nematode worm) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida>
Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae>
Caenorhabditis.
|
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.677 |
| Instability index | 47.78 |
| Isoelectric point | 8.84 |
| Molecular weight | 34782.65 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27584
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 40.14| 12| 15| 11| 22| 1
---------------------------------------------------------------------------
11- 22 (23.43/16.64) CVQ.VDDICQNGM
28- 40 (16.71/ 9.96) CIKlLDELAKIPM
---------------------------------------------------------------------------
|