<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27578

Description Mediator of RNA polymerase II transcription subunit 8
SequenceMNPPVTANYQSEPEKISQATDMMIKRVTDAKKMIEELLQMLDLQEKCPWPPMLEKFSTLASAMSTLQASVRKSGLPHGHEDYGQFLRSHVLVPQRLQYEPDDNLQRVTQGRVFSWNHALVPEYLRTKPNPEMESEENLLDSERSAKAADLVVRQIAAYNKNIDGLMNNLTSIDKLHSEATMEKPTYARDETTRLVKCVLTGEGLRAQRTVQPPPSSSPMVSGSAGNSSMQPSSQPMSSGSAPGMPDFQSSQLRQQLMGPAGGQPQTSQPHMGYGSAFPQQYPHQQPMHQQHSNPMGIMATAQMNMGHPMQRQMQQMPPNMNMHRQ
Length325
PositionHead
OrganismCaenorhabditis brenneri (Nematode worm)
KingdomMetazoa
LineageEukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis.
Aromaticity0.05
Grand average of hydropathy-0.763
Instability index66.28
Isoelectric point6.84
Molecular weight36351.91
Publications









Function






Annotated function

Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors. 


ECO:0000256	RuleBase:RU364144

GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro

GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27578
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     127.16|      30|      32|     230|     261|       1
---------------------------------------------------------------------------
  214-  228 (24.98/ 7.69)	.P.SSSP.MVSGSA..................GNSS
  230-  261 (55.52/30.99)	QP.SSQP.MSSGSApgMP.DFQSSQ.LRQQLMGPAG
  263-  296 (46.67/20.27)	QPqTSQPhMGYGSA..FPqQYPHQQpMHQQHSNPMG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      78.61|      21|      26|      85|     105|       2
---------------------------------------------------------------------------
   85-  105 (38.01/23.44)	FLRSHVLVPQRLQYEPDDNLQ
  113-  133 (40.60/25.49)	FSWNHALVPEYLRTKPNPEME
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      41.37|      12|      26|     173|     184|       3
---------------------------------------------------------------------------
  173-  184 (20.53/10.31)	DKLHSEATMEKP
  202-  213 (20.85/10.56)	EGLRAQRTVQPP
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27578 with Med8 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) KCVLTGEGLRAQRTVQPPPSSSPMVSGSAGNSSMQPSSQPMSSGSAPGMPDFQSSQLRQQLMGPAGGQPQTSQPHMGYGSAFPQQYPHQQPMHQQHSNPMGIMATAQMNMGHPMQRQMQQMPPNMNMHRQ
196
325










Molecular Recognition Features






MoRF SequenceStartStop




NANANA