Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MNEPTTSFASSKERMSIKNNTFYLLKSNLPPYSEIQGNHDLLTAHGLGPVDGGFTGTRRVKEKMSAFLPHVIGEFHLDATKDASSLKALIEKPPIHKEISNLSNSAMQGFKLSAGPVDERYRHLFEKRKDDGMLAHSEKLNLIRVKQGYDAFGVEEDETEKQFPRKHKKKKKDKKRKKEKEGSSDIVSEKKKRVDESMEF |
Length | 200 |
Position | Head |
Organism | Caenorhabditis brenneri (Nematode worm) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Ecdysozoa> Nematoda> Chromadorea> Rhabditida> Rhabditina> Rhabditomorpha> Rhabditoidea> Rhabditidae> Peloderinae> Caenorhabditis. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.956 |
Instability index | 43.35 |
Isoelectric point | 9.43 |
Molecular weight | 22776.68 |
Publications |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27575 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 79.97| 24| 45| 108| 131| 1 --------------------------------------------------------------------------- 108- 131 (40.50/26.92) QGFKLSAGPVDERYRHLFEKRKDD 150- 173 (39.47/26.05) DAFGVEEDETEKQFPRKHKKKKKD --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FPRKHKKKKKDKKRKKEKEGSSDIVSE 2) RYRHLF 3) TFYLL | 163 120 21 | 189 125 25 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab