<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27570

Description Uncharacterized protein (Fragment)
SequenceMVDVPGDGSRVDVRNTTAFLSNSNATTNLPGAINPTAQDDSERPLKRAKIGGHGFRGTGEGGEVATDRAHRTVPGSPLPTLPAPTTATRRNAQQTTTTRPGVDRAARKANGLEPPSIATRVPQPKNVADFSPWHGQHPEDTMSEIVVKQGYSDKAAGPNSTETNSARTTIWPNLSQKNMMGLQTLSYLFTSVMEKRQLLGKCTAPSTFKPPPRVTVTDTKREAWLRDLANPDVPLRKQSRTIPHGIRGKSLMEQCLSKDIPMPRAVWLAKCVGANELRAFRRKGVSGAAAASGESKWVMEWTVHVEQFLEGVIASCGQPDWQAKMDYA
Length328
PositionKinase
OrganismZymoseptoria tritici (strain CBS 115943 / IPO323) (Speckled leaf blotch fungus) (Septoria tritici)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes> Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Zymoseptoria.
Aromaticity0.05
Grand average of hydropathy-0.609
Instability index40.56
Isoelectric point9.74
Molecular weight35627.92
Publications
PubMed=21695235

Function

Annotated function Component of the SRB8-11 complex. The SRB8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The SRB8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex. Component of the srb8-11 complex. The srb8-11 complex is a regulatory module of the Mediator complex which is itself involved in regulation of basal and activated RNA polymerase II-dependent transcription. The srb8-11 complex may be involved in the transcriptional repression of a subset of genes regulated by Mediator. It may inhibit the association of the Mediator complex with RNA polymerase II to form the holoenzyme complex.
ECO:0000256	ARBA:ARBA00002895
ECO:0000256	ARBA:ARBA00003744
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro
GO - Biological Function
transcription coregulator activity	GO:0003712	IEA:InterPro
GO - Biological Process
regulation of transcription by RNA polymerase II	GO:0006357	IEA:InterPro

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP27570
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      97.31|      28|      68|       4|      31|       1
---------------------------------------------------------------------------
    4-   31 (49.79/21.62)	VPGDGSRVDVRNTTAFLSNSNATTNL.PG
   73-  101 (47.52/20.39)	VPGSPLPTLPAPTTATRRNAQQTTTTrPG
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.06|      22|      68|     183|     216|       2
---------------------------------------------------------------------------
  148-  170 (32.94/30.24)	KQGYSDKAAGPnSTETNSARTTI
  195-  216 (40.12/18.09)	KRQLLGKCTAP.STFKPPPRVTV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      50.81|      14|     188|      44|      57|       4
---------------------------------------------------------------------------
   44-   57 (27.58/15.65)	PL.KRAKIGGHGFRG
  234-  248 (23.23/12.25)	PLrKQSRTIPHGIRG
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP27570 with Med12 domain of Kingdom Fungi

Intrinsically Disordered Regions

IDR SequenceStartStop
1) MVDVPGDGSRVDVRNTTAFLSNSNATTNLPGAINPTAQDDSERPLKRAKIGGHGFRGTGEGGEVATDRAHRTVPGSPLPTLPAPTTATRRNAQQTTTTRPGVDRAARKANGLEPPSIATRVPQPKNVADFSPWHGQHPEDTMSEIVVKQGYSDKAAGPNSTETNSARTTIWPNLS
1
175

Molecular Recognition Features

MoRF SequenceStartStop
1) LKRAKIG
45
51