<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27556
Description |
Mediator of RNA polymerase II transcription subunit 31 |
Sequence | MSEEKSTAQTASTANQPSIQYGGHDRFDLELEFVQMLSNPLYLQHLATQKLLDKPEFIAYLNYLQYFREPKYLRYLQYPGPTIRALELLQEERFRKDIIIPEVVNRMVQEGFEASISGS |
Length | 119 |
Position | Middle |
Organism | Zymoseptoria tritici (strain CBS 115943 / IPO323) (Speckled leaf blotch fungus) (Septoria tritici) |
Kingdom | Fungi |
Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Dothideomycetes>
Dothideomycetidae> Mycosphaerellales> Mycosphaerellaceae> Zymoseptoria.
|
Aromaticity | 0.12 |
Grand average of hydropathy | -0.466 |
Instability index | 39.71 |
Isoelectric point | 5.16 |
Molecular weight | 13906.63 |
Publications | PubMed=21695235
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364129
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription, DNA-templated GO:0006355 IEA:InterPro
|
Interaction
Repeat regions
Repeats |
>MDP27556
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 55.91| 15| 28| 32| 46| 2
---------------------------------------------------------------------------
32- 46 (27.35/14.00) EFVQMLSNPLYLQHL
62- 76 (28.56/14.85) NYLQYFREPKYLRYL
---------------------------------------------------------------------------
|