<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27523
| Description |
Uncharacterized protein |
| Sequence | MDYIRTFNGGGSGSLCKLHIWERTGAPPSQRQATPIGAVVLRFTIYDVLTTYISLAPSCEGDSTFVVESVTAFGPREKKLPHMQSDYLAFQSLSQQLAKMVQSDPKVSIQALVDLLCSYQGLFVDRCSTCERVLSAEGHVPPVGRIWVSDRGGGVGIENSTDDNSEGNGSTRGGTGSEITIEGASRNEDTGHGRTRWKKKIGGRWDPRHVTCMHG |
| Length | 215 |
| Position | Tail |
| Organism | Serpula lacrymans var. lacrymans (strain S7.3) (Dry rot fungus) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Basidiomycota> Agaricomycotina> Agaricomycetes>
Agaricomycetidae> Boletales> Coniophorineae> Serpulaceae> Serpula.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.393 |
| Instability index | 46.62 |
| Isoelectric point | 7.00 |
| Molecular weight | 23347.97 |
| Publications | PubMed=21764756
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27523
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.64| 21| 21| 151| 171| 2
---------------------------------------------------------------------------
151- 171 (38.99/17.31) RGG.G..VGIENSTDDNSEGNGST
172- 195 (29.64/11.94) RGGtGseITIEGASRNEDTGHGRT
---------------------------------------------------------------------------
|