<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27511
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MPVEAVLTTVVPAADIDKARSILHGITETRDVAHRFHRVRHVRRLDLSIRGIPIIKSLQSQNPKPETLPQWQDLHSTLSRQQYLLTERVDITQEVLAAMAAGQPVPMSEQTQNGERILRFNDFPDPPNPRVPQTVMQRKQFDIREPGPLLEQHLADSGFSVYSEHIEETYHWWHNNNLEFVLWRQFKDLPDHPQPSPLVHAPDQPNWLVPDLSKLEPISPFWMCFVRAVVDATPVDKMAERMAEAHGRLGAVEQQLEGVYRFMVFDRRAFDTRYQGDDE |
| Length | 279 |
| Position | Head |
| Organism | Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) |
| Kingdom | Fungi |
| Lineage | Eukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes>
Sordariomycetidae> Sordariales> Sordariaceae> Sordaria.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.551 |
| Instability index | 53.74 |
| Isoelectric point | 5.74 |
| Molecular weight | 32313.24 |
| Publications | PubMed=20386741
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27511
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 59.69| 17| 38| 214| 231| 1
---------------------------------------------------------------------------
214- 231 (27.77/23.05) KLEPISPFwMCFVRAVVD
255- 271 (31.92/19.79) QLEGVYRF.MVFDRRAFD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.81| 19| 38| 150| 172| 2
---------------------------------------------------------------------------
150- 172 (29.94/29.24) LEQHLADSGFSvyseHIEETYHW
189- 207 (38.87/25.78) LPDHPQPSPLV....HAPDQPNW
---------------------------------------------------------------------------
|