<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27504

Description Mediator of RNA polymerase II transcription subunit 16
SequenceMSGHDIPIQLLDGSSMDVQHMDTAMNLDDVDVDLFGDSVMVDTALDGLSASRPMPSKHLRQRLDDLRTHGCHQAIAWSRQGTIASITKDGRSVEFRFLRCRPEDAGWELSEPYVYSTAVIPMHTTAGPIVHLAWSNTQAPELAVVDAVGRITILNLTIMLNRPFITRKWDADSVDDLRAVVGCYWLPVFNPRPFNALYGSAVWVQPEDAKALGDGLYKYEVSYAMTTGPHHPNTNRNALISITTNGLLRLVFQNNNGRVEETAIELESITSSDDLITHAALCNDRNTLLIALATASKQLRIVTAMISWGNDKASEKQSHPQNANLTPSLLEHHVAVAPWLQHDSNDPVLDESMSQLSHIEFLPSIPKDKNLQAHYNPVVLTVRSHLPAEGASLYEQEPTSVIDRWEVVSEQPQTLHPAFAQLNTGNITTNPNPMTRLRKLDSVVIPKIVVSVQVMYLGKVVCFAFSDGTIQYRDRVTMMEMFNEHIVHRVLSPHDVGFQYTNDTPCLQVAFSPTNCSYVQISDDWDIKWNSMRYTLADPSTALQDAQQSAVMAALILALSSTVTASNNFDDILAMARPFNENPQFAASWVRGTVNLLKMNFDFSDEALNDSLIRNPFLQMCLSILSHMSFRGEFRPRSYEGKLSFLILQVRNFIVLVSLSLNAPKSLGTSPLDESEVVEVLVGCVTWAHTLMGWVVDCLFDLADDPAFMSILNEQKRFPDLANFLKARGDVSLHLLCCSSARGLITAACRRLAHLEGMSFRAVRYWEASRLKTENNDGSGGGKVLPDSLYFAYQKMQHSAQACLIKVQEFEKILQGFAQDVRTAYQTSLSRRQSGSQQPPQQHPSPQQNKNQQPQNAEDQFIKKAQAHCELDMLLGANPPPCFREVLLKFFTQTLPVLKSHVDPAKLYFANYEILDIEENPRILAARKARRKYIDVFTRREITFPTTSSGDAARGGGGSGGVGGEEDVKRGGAVGAGEGQTPNQNTLALGGGGISIKIELGAAGSTPNLKGGISTPGGRWW
Length1021
PositionTail
OrganismSordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Sordariaceae> Sordaria.
Aromaticity0.08
Grand average of hydropathy-0.216
Instability index42.21
Isoelectric point5.86
Molecular weight112984.96
Publications
PubMed=20386741

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
mediator complex	GO:0016592	IEA:InterPro

GO - Biological Function
GO - Biological Process








Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27504
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     103.62|      31|     103|     101|     139|       1
---------------------------------------------------------------------------
  101-  139 (47.51/55.78)	RPEDA...GWELsepYVYStavIPMHTTAGPivHLAWSNTQA
  205-  238 (56.10/38.78)	QPEDAkalGDGL...YKYE...VSYAMTTGP..HHPNTNRNA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      73.73|      21|     109|      52|      72|       2
---------------------------------------------------------------------------
   52-   72 (41.96/29.70)	RPMPSKHL.RQRLDDLR.THGCH
  162-  184 (31.77/20.55)	RPFITRKWdADSVDDLRaVVGCY
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     125.01|      37|     177|     298|     398|       5
---------------------------------------------------------------------------
  346-  383 (59.07/134.26)	DPVLDESMSQLSHIEFLPSIpKDKNLQAHYNPVVLTVR
  615-  651 (65.94/16.48)	NPFLQMCLSILSHMSFRGEF.RPRSYEGKLSFLILQVR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      52.93|      15|     177|     298|     338|       7
---------------------------------------------------------------------------
  321-  338 (22.45/60.15)	QNANLTPSLlehHVAVAP
  499-  513 (30.48/ 6.95)	QYTNDTPCL...QVAFSP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      49.85|      13|     383|     192|     204|      10
---------------------------------------------------------------------------
  192-  204 (26.50/17.79)	RPFN.ALYGSAVWV
  577-  590 (23.35/14.71)	RPFNeNPQFAASWV
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.46|      12|     115|     783|     794|      12
---------------------------------------------------------------------------
  783-  794 (23.62/16.23)	KVLPDSLYFA.YQ
  901-  913 (19.85/12.41)	HVDPAKLYFAnYE
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      48.93|      13|      33|     946|     958|      14
---------------------------------------------------------------------------
  946-  958 (24.08/12.12)	TTSSGDAARGGGG
  981-  993 (24.85/12.72)	TPNQNTLALGGGG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27504 with Med16 domain of Kingdom Fungi
Unable to open file!