<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27500

Description "WGS project CABT00000000 data, contig 2.5"
SequenceMSDRLSQLQEAVDQLMEQFIATYFYIDRHHDLKTFGTKDTIAPSKADQPPEVDTLPPDVFQAGQLELARDLITREQQIEYLISSLPGLDNSEHDQMQSIRELEEELRVAEKQRQEAVKEKDEVLVKLDQTLRSIRRY
Length137
PositionMiddle
OrganismSordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell)
KingdomFungi
LineageEukaryota> Fungi> Dikarya> Ascomycota> Pezizomycotina> Sordariomycetes> Sordariomycetidae> Sordariales> Sordariaceae> Sordaria.
Aromaticity0.06
Grand average of hydropathy-0.746
Instability index55.92
Isoelectric point4.68
Molecular weight16000.74
Publications
PubMed=20386741

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	ARBA:ARBA00003669
ECO:0000256	RuleBase:RU366036
GO - Cellular Component
core mediator complex	GO:0070847	IEA:EnsemblFungi
mediator complex	GO:0016592	IEA:UniProtKB-UniRule
GO - Biological Function
RNA polymerase II repressing transcription factor binding	GO:0001103	IEA:EnsemblFungi
transcription coactivator activity	GO:0003713	IEA:EnsemblFungi
transcription corepressor activity	GO:0003714	IEA:EnsemblFungi
GO - Biological Process
negative regulation of transcription by RNA polymerase II	GO:0000122	IEA:EnsemblFungi
positive regulation of transcription by RNA polymerase II	GO:0045944	IEA:EnsemblFungi

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP27500
No repeats found
No repeats found




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27500 with Med21 domain of Kingdom Fungi


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




NANANA









Molecular Recognition Features






MoRF SequenceStartStop




1) KDTIA
2) VFQAGQLELARDLITREQQIEYLISSLPGLDNSEHDQMQSIRELEEELR
38
59
42
107