<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27494
| Description |
Cyclin C |
| Sequence | GGCSECLQWILDKQDLLKERQKDLKFLSEEEYWKLQIFFTNVIQALGEHLKLRQQVIATATVYFKRFYARYSLKSIDPVLMAPTLKTRFSYAFPKEFPYRMNHILECEFYLLELMDCCLIVYHPYRPLLQYVQDMGQEDMLLPLAWRIVNDTYRTDLCLLYPPFMIALACLHVACVVQQKDARQWFAELSVDMEKILEIIRVILKLYEQWKNFDERKEMATILSKMPKPKPPPNSEGEQGPNGSQNSSYSQS |
| Length | 252 |
| Position | Kinase |
| Organism | Callithrix jacchus (White-tufted-ear marmoset) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Callitrichinae> Callithrix> Callithrix.
|
| Aromaticity | 0.12 |
| Grand average of hydropathy | -0.246 |
| Instability index | 54.52 |
| Isoelectric point | 6.51 |
| Molecular weight | 29775.41 |
| Publications | PubMed=25243066
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | cyclin-dependent protein serine/threonine kinase regulator activity GO:0016538 IEA:InterPro
identical protein binding GO:0042802 IEA:Ensembl
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27494
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 69.41| 19| 23| 67| 89| 1
---------------------------------------------------------------------------
71- 89 (32.41/26.16) YSLKSIDPVLMAPTLKTRF
91- 109 (37.00/18.69) YAFPKEFPYRMNHILECEF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 41.35| 13| 24| 184| 197| 2
---------------------------------------------------------------------------
184- 197 (20.63/17.85) QW..FAELSvDMEKIL
209- 223 (20.73/12.57) QWknFDERK.EMATIL
---------------------------------------------------------------------------
|