<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27492
| Description |
Mediator complex subunit 28 |
| Sequence | MSRDHALFPPPSHVTFCAKFRAGAVDLSCAIPDMAAPLGGMFSGQPPGPPQPPPGLPGQASLLQAAPGAPRPSNSTLVDELESSFEACFASLVSQDYVSGTDQEEIRTGVDQCIQKFLDIARQTECFFLQKRLQLSVQKPEQVIKEDVSELRNELQRKDALVQKHLTKLRHWQQVLEDINVQHKKPADIPQGSLAYLEQASANIPAPLKPT |
| Length | 211 |
| Position | Head |
| Organism | Callithrix jacchus (White-tufted-ear marmoset) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.373 |
| Instability index | 59.82 |
| Isoelectric point | 5.73 |
| Molecular weight | 23086.03 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27492
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 54.15| 15| 35| 23| 37| 3
---------------------------------------------------------------------------
23- 37 (27.31/14.13) GAVDLSCAIPDMAAP
58- 72 (26.84/13.78) GQASLLQAAPGAPRP
---------------------------------------------------------------------------
|