<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27482
Description |
Mediator complex subunit 29 |
Sequence | MLKSNRERHTCDALPAVVRKMAASQQQASAASSAAGVSGPSSTGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLRLAHECLSQSCDSAKHSPTLVPTATKPDAVQPDSLPYPQYLAVIKAQITCAKDIHTALLDCANKVTGKTPAPPAGPGGTL |
Length | 220 |
Position | Tail |
Organism | Callithrix jacchus (White-tufted-ear marmoset) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Callitrichinae> Callithrix> Callithrix.
|
Aromaticity | 0.03 |
Grand average of hydropathy | -0.407 |
Instability index | 66.15 |
Isoelectric point | 7.55 |
Molecular weight | 23423.41 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
nucleoplasm GO:0005654 IEA:Ensembl
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27482
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 44.15| 13| 22| 25| 40| 1
---------------------------------------------------------------------------
25- 40 (17.90/12.25) QQQasaASSAAGVSGP
49- 61 (26.25/11.27) QQQ...PQPPAQLVGP
---------------------------------------------------------------------------
|