<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27480
Description |
Mediator complex subunit 29 |
Sequence | MAASQQQASAASSAAGVSGPSSTGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLPPSLTQCSLTACPTHSTWRSSKPRLPVPKTFTPLCWTVPTRSRARRLHHLLALVAPCEDGGREWGRQLVGGVQRE |
Length | 195 |
Position | Tail |
Organism | Callithrix jacchus (White-tufted-ear marmoset) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae>
Callitrichinae> Callithrix> Callithrix.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.497 |
Instability index | 68.59 |
Isoelectric point | 8.75 |
Molecular weight | 21210.88 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27480
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.21| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
19- 37 (39.07/14.54) GPSSTGGPGPQQQPQPPAQ
40- 58 (35.14/12.50) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 42.98| 12| 19| 134| 145| 2
---------------------------------------------------------------------------
134- 145 (23.98/13.45) THSTW....RSSKPRL
152- 167 (19.01/ 9.48) TPLCWtvptRSRARRL
---------------------------------------------------------------------------
|