Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | MENFTALFGAQADPPPPPTALGFGPGKPPPPPPPPPGGGPGTAPPPTAATAPPGADKSGAGCGPFYLMRELPGSTELTGSTNLITHYNLEQAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPILSSSFNPITGTMLAGFRLHTGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPGKPS |
Length | 194 |
Position | Head |
Organism | Macaca mulatta (Rhesus macaque) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca. |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.623 |
Instability index | 61.15 |
Isoelectric point | 9.43 |
Molecular weight | 20457.28 |
Publications | PubMed=17431167 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
GO - Cellular Component | mediator complex GO:0016592 IEA:Ensembl |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27477 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 53.00| 14| 39| 67| 80| 7 --------------------------------------------------------------------------- 67- 80 (25.31/12.83) LMRELPGSTELTGS 108- 121 (27.69/14.66) FLPDLPGMIDLPGS --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) FGPGKPPPPP 2) MENFT 3) QPPKKKNKHKHKQSRT | 23 1 169 | 32 5 184 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab