<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27474

Description Transducin beta like 1 X-linked
SequenceMTELAGASSSCCHRPAGRGAMQSVLHHFQRLRGREGGSHFINTSSPRGEAKMSITSDEVNFLVYRYLQESGFSHSAFTFGIESHISQSNINGTLVPPAALISILQKGLQYVEAEISINEDGTVFDGRPIESLSLIDAVMPDVVQTRQQAFREKLAQQQASAAAAAAAATTSASVSQQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVDIPSSKATVLRGHESEVFICAWNPVSDLLASGSGDSTARIWNLNENSNGGSTQLVLRHCIREGGHDVPSNKDVTSLDWNTNGTLLATGSYDGFARIWTEDGNLASTLGQHKGPIFALKWNRKGNYILSAGVDKTTIIWDAHTGEAKQQFPFHSAPALDVDWQNNMTFASCSTDMCIHVCRLGCDRPVKTFQGHTNEVNAIKWDPSGMLLASCSDDMTLKIWSMKQEVCIHDLQAHNKEIYTIKWSPTGPATSNPNSNIMLASASFDSTVRLWDIERGVCTHTLTKHQEPVYSVAFSPDGRYLASGSFDKCVHIWNTQSGNLVHSYRGTGGIFEVCWNARGDKVGASASDGSVSNTSGLLP
Length570
PositionTail
OrganismMacaca mulatta (Rhesus macaque)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Catarrhini> Cercopithecidae> Cercopithecinae> Macaca.
Aromaticity0.07
Grand average of hydropathy-0.352
Instability index40.91
Isoelectric point5.98
Molecular weight61843.18
Publications
PubMed=17431167

Function

Annotated function 
GO - Cellular Component
histone deacetylase complex	GO:0000118	IBA:GO_Central

GO - Biological Function
transcription corepressor activity	GO:0003714	IBA:GO_Central

GO - Biological Process
histone deacetylation	GO:0016575	IBA:GO_Central
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27474
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             7|     380.10|      40|      40|     377|     416|       1
---------------------------------------------------------------------------
  257-  292 (44.28/21.94)	S.NGGSTQLVLR...HCirEGGHDVP..S....NKD...........VTSLDWNTNG
  295-  333 (61.17/32.92)	L.ATGSYDGFAR...I...WTEDGNLASTLGQHKGP...........IFALKWNRKG
  335-  372 (22.65/ 7.89)	Y..............IL..SAGVDKTTIIWDAHTGEakqqfpfhsapALDVDWQ...
  377-  416 (69.55/38.36)	F.ASCSTDMCIH...VC..RLGCDRPVKTFQGHTNE...........VNAIKWDPSG
  419-  458 (66.77/36.55)	L.ASCSDDMTLK...IW..SMKQEVCIHDLQAHNKE...........IYTIKWSPTG
  470-  509 (52.50/27.28)	L.ASASFDSTVRlwdIE..RGVC...THTLTKHQEP...........VYSVAFSPDG
  511-  550 (63.17/34.22)	YlASGSFDKCVH...IW..NTQSGNLVHSYRG.TGG...........IFEVCWNARG
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27474 with Med16 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) AAAATTSASVSQQNPSKNREATVNGEENRAHSVNNHAKPMEIDGEVDIPSSKA
165
217










Molecular Recognition Features






MoRF SequenceStartStop




NANANA