<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27454
Description |
Uncharacterized protein |
Sequence | MAASQQQASAASSAAGVSGPSSAGGPGPQQQPQPPAQLVGPAQSGLLQQQQQDFDPVQRYKMLIPQLKESLQTLMKVAAQNLIQNTNIDNGQKSSDGPIQRFDKCLEEFYALCDQLELCLPPSPTRCSLTASPTHSTWQSSKPRFPVPRTFTPPCWTVPTRSRARHPPHLLALGAPCEWGRQWLEGGVQRE |
Length | 191 |
Position | Tail |
Organism | Macaca mulatta (Rhesus macaque) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.594 |
Instability index | 70.42 |
Isoelectric point | 8.60 |
Molecular weight | 20779.24 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27454
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 74.00| 19| 19| 19| 37| 1
---------------------------------------------------------------------------
19- 37 (38.84/15.56) GPSSAGGPGPQQQPQPPAQ
40- 58 (35.16/13.45) GPAQSGLLQQQQQDFDPVQ
---------------------------------------------------------------------------
|