<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27451
| Description |
Uncharacterized protein |
| Sequence | MEDEIIRIAKKMDKMVQKKNAAGALDLLKELKNIPMTLELLQSTRIGMSVNAIRKQSTDEEVTSLAKSLIKSWKKLLDGPSTDKDSDEKKKRTLLSPPKIALKQKKKSSSSSNASNRKEETNASDSFIPSFPRAPSTSDSVRMKCREMLAAALRTGDDYIAIGADEEELGSQIEEAIYQELRNTDMKYKNRVRSRIANLKDAKNPNLRKNVLCGNIPPDLFARMTAEEMASDELKEMRKNLTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSADEPMTTFVVCNECGNRWKFC |
| Length | 302 |
| Position | Unknown |
| Organism | Monodelphis domestica (Gray short-tailed opossum) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Didelphimorphia> Didelphidae> Monodelphis.
|
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.769 |
| Instability index | 46.59 |
| Isoelectric point | 9.29 |
| Molecular weight | 34043.79 |
| Publications | PubMed=17495919
|
Function
| Annotated function |
|
| GO - Cellular Component | nucleus GO:0005634 IEA:UniProtKB-SubCell
|
| GO - Biological Function | nucleic acid binding GO:0003676 IEA:InterPro
zinc ion binding GO:0008270 IEA:InterPro
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
transcription, DNA-templated GO:0006351 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27451
No repeats found
|