<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27448
Description |
Mediator of RNA polymerase II transcription subunit 16 |
Sequence | LPQGSPVRPGHSFLRDGASLGMLRELMVVIRIWGLLKPSCLPIYTATSDTQDSMSLLFRLLTKLWLCCKKEACQSLMVPIWQRPDSLPNTGRDENHPSEPDETLIDECCLLPSQLLIPNLDWLPVSDGIVNKLQGKQLLRLQFGKPPGLLGYPVTPQFDLFARGPGQPKIDHLRRLHLGAYPTEECKSCTRTKEFQARGRMWARGHMWGRESSCIRRCGCVTMLKSPNKTTAVKQWEQRWIKNCLCGGLWRRVP |
Length | 254 |
Position | Tail |
Organism | Ornithorhynchus anatinus (Duckbill platypus) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.334 |
Instability index | 63.73 |
Isoelectric point | 9.34 |
Molecular weight | 28872.55 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27448
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 91.74| 29| 33| 2| 33| 1
---------------------------------------------------------------------------
2- 33 (46.40/42.53) PQGSPVRPGHSFLRDGASLgMLR...............ELMvvIRIW
38- 81 (45.34/29.91) PSCLPIYTATSDTQDSMSL.LFRlltklwlcckkeacqSLM..VPIW
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 97.34| 28| 33| 137| 164| 2
---------------------------------------------------------------------------
137- 164 (52.46/27.77) QLLRLQFGKPPG..LLGYPVTPQFD....LFARG
172- 205 (44.88/22.88) HLRRLHLGAYPTeeCKSCTRTKEFQargrMWARG
---------------------------------------------------------------------------
|