<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27431
| Description |
Mediator of RNA polymerase II transcription subunit 18 |
| Sequence | MEAPPVTMMPVTGGTVNMMEYLLQGSVLDHSLESLLHRLRGLCDNVEPEAFLDHEMVFLLKGQQASPFVLRARRSLAPAGMPWHLRYLGQPEMGDKNRQALVRNSVDIATSENLTDFLMEMGFRLDHEFVAKGHLFRKGAMKVCVYKVFRVLLPGNTDSIEALSLSYLVELSVVAPAGQDGVSEDMRNFAEQLKPLVHLEKIDPKRLM |
| Length | 208 |
| Position | Head |
| Organism | Ornithorhynchus anatinus (Duckbill platypus) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.064 |
| Instability index | 43.17 |
| Isoelectric point | 5.97 |
| Molecular weight | 23363.98 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27431
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 35.83| 10| 27| 28| 37| 1
---------------------------------------------------------------------------
28- 37 (17.70/11.72) LDHSLESLLH
52- 61 (18.13/12.17) LDHEMVFLLK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 49.40| 15| 27| 162| 176| 2
---------------------------------------------------------------------------
162- 176 (23.85/12.11) ALSLSYLVELSVVAP
190- 204 (25.55/13.33) AEQLKPLVHLEKIDP
---------------------------------------------------------------------------
|