| Description | Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFSALFGTQTEPPPPPPAALGFGPGKPPPPPPPPPGGGPGTVPPPAAVPSAPGADKAAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSGLRSLIEKPPILGGSFNPITGTMLAGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEHPGMGSSQASSSSSLR |
| Length | 245 |
| Position | Head |
| Organism | Monodelphis domestica (Gray short-tailed opossum) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Metatheria> Didelphimorphia> Didelphidae> Monodelphis. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.977 |
| Instability index | 68.95 |
| Isoelectric point | 9.83 |
| Molecular weight | 26352.96 |
| Publications | PubMed=17495919 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364151 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro transcription factor binding GO:0008134 IBA:GO_Central |
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP27425
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 80.55| 16| 17| 191| 206| 1
---------------------------------------------------------------------------
171- 184 (25.73/10.82) P..PKKKNKHKHKQSR
191- 206 (27.72/12.15) PETPSDSDHKKKKKKK
210- 225 (27.09/11.74) PERKRKKKEKKKKKNR
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 61.11| 12| 15| 8| 19| 2
---------------------------------------------------------------------------
8- 19 (29.06/ 6.94) FGTQTEPPPPPP
24- 35 (32.05/ 8.26) FGPGKPPPPPPP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 92.62| 19| 38| 63| 81| 4
---------------------------------------------------------------------------
63- 81 (36.28/17.55) CGP......FYLMRELPGSTELTGS
98- 122 (29.88/13.25) CGKkvkeklSNFLPDLPGMIDLPGS
126- 141 (26.46/10.96) SGL......RSLIEKPP...ILGGS
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) DSDHKKKKKKKEEDPERKRKKKEKKKKKNRHSPEH 2) MENFSA | 196 1 | 230 6 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab