<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27393

Description Mediator of RNA polymerase II transcription subunit 4
SequenceMPRRIRLWSTPCSRFGCRSQGFYRKALAGPADGAGVRSAPPGAQGAVSPGLSFLHWVTLLPSEPAYPPRPCVSMHCACASGGTVGSMAASSSGEKEKERLGGGLGVASGNSTRERLLSALEDLEVLSRELIEMLAISRNQKLLQAGEENQVLELLIHRDGEFQELMKLAVNQGKIHHEMQVLEKEVEKRDSDIQQLQKQLKEAEQILATAVYQAKEKLKSIEKARKGAISSEEIIKYAHRISASNAVCAPLTWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAGRLPDVLAPQYPWQSNDMAMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD
Length356
PositionMiddle
OrganismCallithrix jacchus (White-tufted-ear marmoset)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Euarchontoglires> Primates> Haplorrhini> Platyrrhini> Cebidae> Callitrichinae> Callithrix> Callithrix.
Aromaticity0.04
Grand average of hydropathy-0.480
Instability index54.09
Isoelectric point5.79
Molecular weight38684.34
Publications
PubMed=25243066

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
ECO:0000256	RuleBase:RU364141
GO - Cellular Component
mediator complex	GO:0016592	IEA:Ensembl
nucleoplasm	GO:0005654	IEA:Ensembl
GO - Biological Function
thyroid hormone receptor binding	GO:0046966	IEA:Ensembl
transcription coactivator activity	GO:0003713	IEA:Ensembl
GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
transcription by RNA polymerase II	GO:0006366	IEA:Ensembl

Interaction

Binary Interactions











Repeat regions





Repeats

>MDP27393
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      69.21|      25|      29|     114|     140|       1
---------------------------------------------------------------------------
  116-  140 (40.75/30.49)	LLSALED...LEVL.SR..ELIEMLAISRNQ
  142-  172 (28.46/13.27)	LLQAGEEnqvLELLiHRdgEFQELMKLAVNQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|     103.43|      25|     237|      42|      67|       2
---------------------------------------------------------------------------
   42-   67 (44.54/29.30)	GAQGAVsPGLSFLHWVTLLPS..EPAYP
  251-  263 (20.21/ 7.42)	............LTWVPGDPR..RP.YP
  283-  307 (38.67/20.83)	GVNGHL.PGDALA..AGRLPDvlAPQYP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.80|      15|      23|      81|      95|       3
---------------------------------------------------------------------------
   81-   95 (25.60/16.02)	GGTVGSMAASSSGEK
  101-  115 (26.20/16.56)	GGGLGVASGNSTRER
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      65.92|      22|      23|     180|     201|       4
---------------------------------------------------------------------------
  180-  201 (33.52/24.86)	QVLEKEVEKRDSDIQQLQKQLK
  205-  226 (32.40/23.81)	QILATAVYQAKEKLKSIEKARK
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27393 with Med4 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) TWVPGDPRRPYPTDLEMRSGLLGQMNNPSTNGVNGHLPGDALAAG
2) WQSNDMAMNMLPPNHSSDFLLEPPGHNKENEDDVEIMSTDSSSSSSESD
252
308
296
356










Molecular Recognition Features






MoRF SequenceStartStop




1) MPRRIRLWST
1
10