<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27390

Description Transcription elongation factor A2
SequenceMPITLDLLQSTRIGMSVNALRKQSTDDEVISLAKSLIKSWKKLLGLDASEERNDEKKKNSYLPKSSSKDATDTKDQSAIKKQESPKTPTTPKITTFPPVPITCDAVRNKCREMLTAALQTDNDHIAIGTDCEHLSAQIEEYIYQDVKNTDMKYKNRVRSRISNLKDSKNPDLRKNVLCGAITPEQIAVMTSEEMASNELKEIRKAMTKEAIREHQMAKTGGTQTDLFTCGKCKKKNCTYTQVQTRSSDEPMTTFVVCNECGNRWKFC
Length267
PositionUnknown
OrganismOrnithorhynchus anatinus (Duckbill platypus)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Monotremata> Ornithorhynchidae> Ornithorhynchus.
Aromaticity0.04
Grand average of hydropathy-0.757
Instability index51.59
Isoelectric point8.89
Molecular weight30111.13
Publications









Function






Annotated function


GO - Cellular Component
GO - Biological Function
nucleic acid binding	GO:0003676	IEA:InterPro
zinc ion binding	GO:0008270	IEA:InterPro

GO - Biological Process
transcription, DNA-templated	GO:0006351	IEA:InterPro









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27390
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      36.61|      11|      19|     144|     155|       1
---------------------------------------------------------------------------
  144-  155 (16.08/13.45)	QDVKNTDMKyKN
  165-  175 (20.53/11.32)	KDSKNPDLR.KN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      53.45|      14|      27|     224|     237|       2
---------------------------------------------------------------------------
  224-  237 (28.18/16.18)	TDLFTCGKC..KKKNC
  252-  267 (25.27/13.89)	TTFVVCNECgnRWKFC
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      58.98|      18|      19|      47|      64|       3
---------------------------------------------------------------------------
   47-   64 (29.79/15.53)	DASEERNDEKKKNSYLPK
   69-   86 (29.18/15.09)	DATDTKDQSAIKKQESPK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      85.85|      26|      95|       2|      29|       4
---------------------------------------------------------------------------
    2-   29 (38.65/34.94)	PITLDLLQSTRIGMSVNALrkQSTDDEV
  100-  125 (47.20/35.20)	PITCDAVRNKCREMLTAAL..QTDNDHI
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27390 with Med26 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) ERNDEKKKNSYLPKSSSKDATDTKDQSAIKKQESPKTPTTPKITTFPP
51
98










Molecular Recognition Features






MoRF SequenceStartStop




NANANA