<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27384
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | MENFTALFGTQTEPPPPPPAALGFGPGKPSTPPPPPPGGGPGTVPPPAAVPSAPGADKAAAGCGPFYLMRELPGSTELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSGLRSLIEKPPILGGSFNPITGTMLAGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPS |
| Length | 195 |
| Position | Head |
| Organism | Monodelphis domestica (Gray short-tailed opossum) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Didelphimorphia> Didelphidae> Monodelphis.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.550 |
| Instability index | 64.16 |
| Isoelectric point | 9.17 |
| Molecular weight | 20536.38 |
| Publications | PubMed=17495919
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
transcription factor binding GO:0008134 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription by RNA polymerase II GO:0045944 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27384
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 110.89| 31| 46| 69| 99| 3
---------------------------------------------------------------------------
69- 99 (57.82/29.11) MRELPGSTELTGSTNLITHYN.LEHAYNKFCG
116- 147 (53.06/26.25) MIDLPGSHDNSGLRSLIEKPPiLGGSFNPITG
---------------------------------------------------------------------------
|