<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27379
Description |
Mediator of RNA polymerase II transcription subunit 7 |
Sequence | VIERAEVLENFKMGEPQQVSALPPPPMQYIKEYTDENIRKGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQNCLASLPDDLPHTEGGMRLKTEPMDTDDSKNCIGQNEQRENSSHRRDQIIEKDAALCILIDEMNERP |
Length | 244 |
Position | Middle |
Organism | Monodelphis domestica (Gray short-tailed opossum) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Metatheria> Didelphimorphia> Didelphidae> Monodelphis.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.701 |
Instability index | 49.81 |
Isoelectric point | 5.77 |
Molecular weight | 28677.77 |
Publications | PubMed=17495919
|
Function
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
nuclear body GO:0016604 IEA:Ensembl
transcription regulator complex GO:0005667 IEA:Ensembl
|
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
Repeats |
>MDP27379
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.03| 14| 26| 10| 35| 1
---------------------------------------------------------------------------
10- 28 (25.42/37.06) NFKMG.EPQqvsalPPPPMQ
37- 51 (24.61/ 7.66) NIRKGlAPK.....PPPPIK
---------------------------------------------------------------------------
|