<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27376
| Description |
Mediator of RNA polymerase II transcription subunit 9 |
| Sequence | LYSLGIAQNAPSTSVLTPPSVAPATHPSVAPATHPSVAPATHPSVAPATHPSVAPARARSSNHYTFLPLVHDIIKCMDKDSQDVYQELNELKSKFQAMRKLVGNMPGIDLSPEEQQRHLQSLREQVQTKNELLQKYKSLCMFEIPKE |
| Length | 147 |
| Position | Middle |
| Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.05 |
| Grand average of hydropathy | -0.433 |
| Instability index | 69.58 |
| Isoelectric point | 8.00 |
| Molecular weight | 16174.29 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27376
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
3| 57.77| 14| 14| 23| 36| 1
---------------------------------------------------------------------------
11- 34 (24.43/12.07) PStsvltppsvaPATHPSVAPATH
35- 47 (16.98/ 6.49) PS........vaPATHPSVAP...
49- 58 (16.36/ 6.03) ..............THPSVAPARA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 45.46| 14| 22| 89| 102| 2
---------------------------------------------------------------------------
89- 102 (22.39/15.47) NELKSKFQAMRKLV
113- 126 (23.07/16.12) EEQQRHLQSLREQV
---------------------------------------------------------------------------
|