<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27370
Description |
Uncharacterized protein |
Sequence | MAHMQEEPRRSQSAVEFNPVSLYQAGQDIVQDIAQKAQEIFQALKLSQLPNGIATGQRNAQERINKLKDLLNKVEVLFKQLRVIYNECQKRVGDVEPNVNTLVPILKEIPNTEHEQALKSHKELVLQSRKKDLEMKLCMKNKQLETLVAQMTDFVWDINAALASPYGS |
Length | 168 |
Position | Head |
Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
Aromaticity | 0.05 |
Grand average of hydropathy | -0.492 |
Instability index | 53.26 |
Isoelectric point | 7.75 |
Molecular weight | 19166.87 |
Publications | PubMed=12481130
PubMed=15114417
|
Function
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
GO - Biological Function | transcription coregulator activity GO:0003712 IBA:GO_Central
|
GO - Biological Process | positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
|
Interaction
Repeat regions
Repeats |
>MDP27370
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 65.37| 21| 22| 24| 45| 1
---------------------------------------------------------------------------
24- 45 (29.96/21.26) QAGQDIVQDiAQKAQEIFQALK
48- 68 (35.41/20.82) QLPNGIATG.QRNAQERINKLK
---------------------------------------------------------------------------
|