<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27359

Description Mediator complex subunit 30
SequenceMSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPGEQLIPYMEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN
Length178
PositionHead
OrganismEquus caballus (Horse)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Perissodactyla> Equidae> Equus.
Aromaticity0.06
Grand average of hydropathy-0.629
Instability index46.19
Isoelectric point8.45
Molecular weight20274.04
Publications
PubMed=19892987

Function

Annotated function
GO - Cellular Component
mediator complex	GO:0016592	IBA:GO_Central
GO - Biological Function
thyroid hormone receptor binding	GO:0046966	IEA:Ensembl
transcription coactivator activity	GO:0003713	IEA:Ensembl
transcription coregulator activity	GO:0003712	IBA:GO_Central
GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
positive regulation of transcription, DNA-templated	GO:0045893	IBA:GO_Central
stem cell population maintenance	GO:0019827	IEA:Ensembl

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP27359
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      68.58|      21|      69|      77|      97|       1
---------------------------------------------------------------------------
   77-   97 (35.66/18.13)	KLQDHLRQLSILFRKLR.LVYD
  148-  169 (32.91/16.37)	KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP27359 with Med30 domain of Kingdom Metazoa

Intrinsically Disordered Regions

IDR SequenceStartStop
1) LIPYMEEDGSKNDDRAGPPRFASEERREIAEVNKK
114
148

Molecular Recognition Features

MoRF SequenceStartStop
NANANA