<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27359
| Description |
Mediator complex subunit 30 |
| Sequence | MSTPPLAASGMAPGPFAGPQAQQAAREVNTASLCRIGQETVQDIVYRTMEIFQLLRNMQLPNGVTYHTGTYQDRLAKLQDHLRQLSILFRKLRLVYDKCNENCGGMDPIPGEQLIPYMEEDGSKNDDRAGPPRFASEERREIAEVNKKLKQKNQQLKQIMDQLRNLIWDINAMLAMRN |
| Length | 178 |
| Position | Head |
| Organism | Equus caballus (Horse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Perissodactyla> Equidae> Equus.
|
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.629 |
| Instability index | 46.19 |
| Isoelectric point | 8.45 |
| Molecular weight | 20274.04 |
| Publications | PubMed=19892987
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | thyroid hormone receptor binding GO:0046966 IEA:Ensembl
transcription coactivator activity GO:0003713 IEA:Ensembl
transcription coregulator activity GO:0003712 IBA:GO_Central
|
| GO - Biological Process | positive regulation of transcription initiation from RNA polymerase II promoter GO:0060261 IEA:Ensembl
positive regulation of transcription, DNA-templated GO:0045893 IBA:GO_Central
stem cell population maintenance GO:0019827 IEA:Ensembl
|
Interaction
Repeat regions
| Repeats |
>MDP27359
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 68.58| 21| 69| 77| 97| 1
---------------------------------------------------------------------------
77- 97 (35.66/18.13) KLQDHLRQLSILFRKLR.LVYD
148- 169 (32.91/16.37) KLKQKNQQLKQIMDQLRnLIWD
---------------------------------------------------------------------------
|