<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27358
Description |
Mediator of RNA polymerase II transcription subunit 18 |
Sequence | MEAPPVTTMPVSGGTINMMEYLLQVPLIFFFSGSILDQGLESLLHRLRGLCDNMEPETFADHESVYLLKGQQASPFVLRARRPLDRPGAPWHLRYLGQPEAGDRSRHTLVRNCVDIATSDVLPEFLQEMGFRMDHEFVARGHLFRKGVMKVAVYKVFRVLVAGAAEGAEPLSLSYLVELSAVAPAGQDNIADEVRGFAEQLRPLVQLEKIDPKRLM |
Length | 216 |
Position | Head |
Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.08 |
Grand average of hydropathy | -0.053 |
Instability index | 47.07 |
Isoelectric point | 5.88 |
Molecular weight | 24158.71 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27358
No repeats found
|