<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27345
| Description |
Uncharacterized protein |
| Sequence | VAPNDEAVVTLLCEWAVSCKRSGKHRAMAVAKLLEKRQAEIEADRCGESEVLDEKESISSASLAGSSLPVFQNVLLRFLDTQAPSLSDPNSEYEKTEFVNLVLLFCEFIRHDVFSHDAYMCTLISRGDLSITATTRSRSPIGETGEEHYSKDHGGKMEIFSPMPGESCENANPSLDRRISVHNEKLVKREKQRELIFPSNYDLLRHLQYATHFPIPLKDLGSNPCSATCLLCDLGKRRGQAVELVKYAKPSLLESLEQYKWLDEMGVVALGGKARKN |
| Length | 277 |
| Position | Kinase |
| Organism | Ornithorhynchus anatinus (Duckbill platypus) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.06 |
| Grand average of hydropathy | -0.372 |
| Instability index | 57.37 |
| Isoelectric point | 5.96 |
| Molecular weight | 30959.92 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27345
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 67.93| 22| 216| 11| 35| 1
---------------------------------------------------------------------------
11- 35 (34.77/32.35) LLCEWAvscKRSGKHRAM...AVAKLLE
230- 254 (33.16/21.26) LLCDLG...KRRGQAVELvkyAKPSLLE
---------------------------------------------------------------------------
|