<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27335
| Description |
Mediator of RNA polymerase II transcription subunit 1 |
| Sequence | MKAQGETEESEKLSKMSSLLERLHAKFNQNRPWSETIKLVRQVMEKRVVMSSGGHQHLVSCLETLQKALKVTSLPAMTDRLESIARQNGLGSHLSASGTECYITSDMFYVEVQLDPAGQLCDVKVAHHGENPVSCPELVQQLREKNFDEFSKHLKGLVNLYNLPGDNKLKTKMYLALQSLEQDLSKMAVMYWKATNAGPLDKILHGSVGYLTPRSGGHLMNLKYYASPSDLLDDKTSSPIILHENNVPRSLGMNASVTIEGTSAMYKLPIAPLIMGSHPVDNKWTPSFSSITSANSVDLPACFFLKFPQPIPVSRAFVQKLQTCTGIPLFETQPTYVPLYELITQFELSKDPDPIPLNHNMRFYAALPGQQHCYFLNKDAPLPDGRSLQGTLVSKITFQHPGRVPLILNLIRHQVAYNTLIGSCVKRTILKEDSPGLLQFEVCPLSESRFSVSFQHPVNDSLVCVVMDVQDSTHVSCKLYKGLSDALICTDDFIAKVVQRCMSIPVTMRAIRRKAETIQADTPALSLIAETVEDMVKKNLPPASSPGEPGLNCFTLPENQGALHFSTGWRRRGRINQAWDTSLLSRCTHSPVSKDGKDMKSTSTYLLLLVSYVFLV |
| Length | 616 |
| Position | Middle |
| Organism | Equus caballus (Horse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia>
Eutheria> Laurasiatheria> Perissodactyla> Equidae> Equus.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.189 |
| Instability index | 50.74 |
| Isoelectric point | 8.37 |
| Molecular weight | 68506.30 |
| Publications | PubMed=19892987
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27335
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 52.29| 15| 98| 386| 414| 2
---------------------------------------------------------------------------
386- 401 (22.88/38.87) RSLQGTLVSkITFQHP
443- 457 (29.40/10.08) CPLSESRFS.VSFQHP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 118.60| 37| 48| 146| 183| 3
---------------------------------------------------------------------------
146- 183 (59.96/46.49) NFDEFSKHLKGLVNlYNLP..GDNKLKTKMYLALQSLEQD
196- 234 (58.64/40.75) NAGPLDKILHGSVG.YLTPrsGGHLMNLKYYASPSDLLDD
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 60.44| 18| 25| 299| 322| 4
---------------------------------------------------------------------------
302- 319 (34.11/20.03) C....FFLKFPQPIPVSRAFVQ
324- 345 (26.32/14.07) CtgipLFETQPTYVPLYELITQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 77.50| 25| 51| 355| 381| 5
---------------------------------------------------------------------------
355- 381 (46.05/35.12) IPLNHNM.RF...YAALPGQqhCY...FLNKDAP
404- 435 (31.45/17.21) VPLILNLiRHqvaYNTLIGS..CVkrtILKEDSP
---------------------------------------------------------------------------
|