<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27328
| Description |
Mediator complex subunit 28 |
| Sequence | RPPGRPGWFSQRPPGRPGSFSQSPPGRPGSFSQSPLIPSFPSPINPSATSGTYEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFLQKRLHLSVQKPEQVIKEDVSELKNELQRKEALIQKHLGKLRQWQQVLEDINVQHDVPSEMPQGPLAYLEQASANIPAPMKQT |
| Length | 179 |
| Position | Head |
| Organism | Ornithorhynchus anatinus (Duckbill platypus) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.684 |
| Instability index | 71.95 |
| Isoelectric point | 7.02 |
| Molecular weight | 20021.35 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27328
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 73.02| 16| 21| 2| 17| 1
---------------------------------------------------------------------------
2- 17 (40.11/17.16) PPGRPGWFSQRP..PGRP
24- 41 (32.91/13.02) PPGRPGSFSQSPliPSFP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 50.92| 16| 16| 106| 121| 2
---------------------------------------------------------------------------
106- 121 (25.34/16.07) QKPEQVIKEDVSELKN
124- 139 (25.58/16.28) QRKEALIQKHLGKLRQ
---------------------------------------------------------------------------
|