<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27326
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | VIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFRDQEEQAVVKDEKAKRKEEPSSIFQRQRVDALLLDLRQKFPPRYVQQKLGEKPVPVEQTKKEPEPAPETLKPEEKETPKSAQQTAGPKGPPEKRLRLQ |
| Length | 156 |
| Position | Head |
| Organism | Ornithorhynchus anatinus (Duckbill platypus) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.844 |
| Instability index | 56.62 |
| Isoelectric point | 8.89 |
| Molecular weight | 17909.20 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27326
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 72.19| 22| 22| 96| 117| 1
---------------------------------------------------------------------------
96- 117 (39.67/19.55) QKFP...PRYVQQKLGEKPVPVEQT
118- 142 (32.53/14.96) KKEPepaPETLKPEEKETPKSAQQT
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 39.75| 12| 22| 58| 69| 2
---------------------------------------------------------------------------
58- 69 (19.99/15.35) FRDQEEQAVVKD
82- 93 (19.75/15.09) FQRQRVDALLLD
---------------------------------------------------------------------------
|