Description | Mediator of RNA polymerase II transcription subunit 6 |
Sequence | VIPLADYYIIAGVIYQAPDLGSVINSRVLTAVHGIQSAFDEAMSYCRYHPSKGYWWHFRDQEEQVDFSSKAKRKEEPSSIFQRQRVDALLLDLRQKFPPRYVQQKLGEKPVPVEQTKKEPEPAPETLKPEEKETPKSAQQTAGPKGPPEKRLRLQ |
Length | 155 |
Position | Head |
Organism | Ornithorhynchus anatinus (Duckbill platypus) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Monotremata> Ornithorhynchidae> Ornithorhynchus. |
Aromaticity | 0.09 |
Grand average of hydropathy | -0.832 |
Instability index | 56.40 |
Isoelectric point | 8.91 |
Molecular weight | 17803.03 |
Publications | PubMed=18464734 |
Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 PIRNR:PIRNR023869 |
GO - Cellular Component | mediator complex GO:0016592 IEA:InterPro |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27325 --------------------------------------------------------------------------- No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level 2| 72.19| 22| 22| 95| 116| 1 --------------------------------------------------------------------------- 95- 116 (39.67/19.99) QKFP...PRYVQQKLGEKPVPVEQT 117- 141 (32.53/15.31) KKEPepaPETLKPEEKETPKSAQQT --------------------------------------------------------------------------- |
MoRF Sequence | Start | Stop |
1) EPEPAPETLKPEEKETPKSAQQTAGPKGPPEKRLRLQ 2) SKAKRKEEPSSIFQRQRVDALLLDLRQKFPPRYVQQKL | 119 69 | 155 106 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab