| Description | Mediator of RNA polymerase II transcription subunit 7 |
| Sequence | MGEPQQVSALPPPPMQYIKEYTDENIQEGLAPKPPPPIKDSYMMFGNQFQCDDLIIRPLESQGIERLHPMQFDHKKELRKLNMSILINFLDLLDILIRSPGSIKREEKLEDLKLLFVHVHHLINEYRPHQARETLRVMMEVQKRQRLETAERFQKHLERVIEMIQSCLASLPDDLPRSEGGIRVKTEPMDADDSNNCSGQNERQRENSGHRRDQIIEKDAALCVLIDEMNERP |
| Length | 233 |
| Position | Middle |
| Organism | Equus caballus (Horse) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Eutheria> Laurasiatheria> Perissodactyla> Equidae> Equus. |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.734 |
| Instability index | 54.68 |
| Isoelectric point | 5.56 |
| Molecular weight | 27209.92 |
| Publications | PubMed=19892987 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery.
ECO:0000256 RuleBase:RU364060 |
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central nuclear body GO:0016604 IEA:Ensembl transcription regulator complex GO:0005667 IEA:Ensembl |
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central stem cell population maintenance GO:0019827 IEA:Ensembl |
| Binary Interactions |
| Repeats | >MDP27317 No repeats found |
| MoRF Sequence | Start | Stop |
| 1) QYIKEYT 2) VGFRLRWRRRL | 50 11 | 56 21 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab