<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27310
| Description |
Mediator of RNA polymerase II transcription subunit 13 |
| Sequence | MQQSLNRNAPISNSINNIGRSPAQMQSNPTAVALKDTRPVYHPSYNASTACSIVVYLLDPFKNSASRGLWHCFRILQKSLPKPIRDHIIFQIVPIEHVLRVSSPNTRQSFVHVVRSLSFSTFAQCRRNLLHEVKVRSMTGFGPAASDKRYLQENNHNVLNETRLYTPPYVLSVPREGNQINCKHENPPNILFVSYCVSHDQKFVLASATDQCGELLETCCINIDVPPRRLSVSRKHRVSVRSEAIEKLWKFCVTTVSRYSTTTWR |
| Length | 265 |
| Position | Middle |
| Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.348 |
| Instability index | 57.36 |
| Isoelectric point | 9.78 |
| Molecular weight | 30204.28 |
| Publications | PubMed=12481130
PubMed=15114417
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | integral component of membrane GO:0016021 IBA:GO_Central
mediator complex GO:0016592 IEA:InterPro
|
| GO - Biological Function | sugar transmembrane transporter activity GO:0051119 IBA:GO_Central
transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | carbohydrate transport GO:0008643 IBA:GO_Central
regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27310
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 89.74| 31| 58| 167| 197| 1
---------------------------------------------------------------------------
167- 197 (60.84/36.13) PPYVLSVPRE..GNQIN..CKH.ENPPNILFVS.................YCV
201- 253 (28.91/13.81) QKFVLASATDqcGELLEtcCINiDVPPRRLSVSrkhrvsvrseaieklwkFCV
---------------------------------------------------------------------------
|