<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27303
Description |
Mediator of RNA polymerase II transcription subunit 29 (Fragment) |
Sequence | LKLSKWNNSLKNLMKIAAQNLVQNTNIDNGQKNADGLVQRFDKSLEEFYAICDQLELCLRLAYECLSQSYDSAKHSPTLVPTATKPDAVQTESLPYTQYLSMIKSQISCAKDIHNALLECSKKIMGKTPNTQGGL |
Length | 135 |
Position | Tail |
Organism | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.06 |
Grand average of hydropathy | -0.413 |
Instability index | 44.93 |
Isoelectric point | 8.29 |
Molecular weight | 15040.08 |
Publications | |
Function
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process | |
Interaction
Repeat regions
Repeats |
>MDP27303
No repeats found
No repeats found
|