<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27302
| Description |
Mediator of RNA polymerase II transcription subunit 19 |
| Sequence | PSPGGGRRGGGGGLTITISPXCGGFNLCSAGSGELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFNPITGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKTYNRCRLMNRHSPEHPGVGGSQASSSSSSLR |
| Length | 203 |
| Position | Head |
| Organism | Ornithorhynchus anatinus (Duckbill platypus) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.04 |
| Grand average of hydropathy | -0.961 |
| Instability index | 68.02 |
| Isoelectric point | 9.83 |
| Molecular weight | 21968.73 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27302
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 51.10| 14| 18| 128| 143| 1
---------------------------------------------------------------------------
128- 141 (25.66/13.29) PPKKKNKHKHKQSR
147- 160 (25.44/ 7.71) PPETPSDSDHKKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 71.58| 19| 115| 68| 86| 3
---------------------------------------------------------------------------
68- 86 (36.82/22.15) PDLPGMIDLPGSHDNSSLR
185- 203 (34.76/20.52) PEHPGVGGSQASSSSSSLR
---------------------------------------------------------------------------
|