<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27302

Description Mediator of RNA polymerase II transcription subunit 19
SequencePSPGGGRRGGGGGLTITISPXCGGFNLCSAGSGELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFNPITGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPPETPSDSDHKKKKKKKEEDPDRKRKTYNRCRLMNRHSPEHPGVGGSQASSSSSSLR
Length203
PositionHead
OrganismOrnithorhynchus anatinus (Duckbill platypus)
KingdomMetazoa
Lineage
Aromaticity0.04
Grand average of hydropathy-0.961
Instability index68.02
Isoelectric point9.83
Molecular weight21968.73
Publications

Function

Annotated function
GO - Cellular Component
GO - Biological Function
GO - Biological Process

Interaction

Binary Interactions

Repeat regions

Repeats

>MDP27302
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      51.10|      14|      18|     128|     143|       1
---------------------------------------------------------------------------
  128-  141 (25.66/13.29)	PPKKKNKHKHKQSR
  147-  160 (25.44/ 7.71)	PPETPSDSDHKKKK
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      71.58|      19|     115|      68|      86|       3
---------------------------------------------------------------------------
   68-   86 (36.82/22.15)	PDLPGMIDLPGSHDNSSLR
  185-  203 (34.76/20.52)	PEHPGVGGSQASSSSSSLR
---------------------------------------------------------------------------




Explaination for Stockholm format The "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space.

#=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00)

#=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column. It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column. This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.

#=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.

Alignment of MDP27302 with Med19 domain of Kingdom Metazoa

Unable to open file!