Description | Mediator of RNA polymerase II transcription subunit 19 |
Sequence | GERPPPPRPGEGHGEVKAPPRWKVAAHRPPPASRHGLXCGGFNLCSAGSGELTGSTNLITHYNLEHAYNKFCGKKVKEKLSNFLPDLPGMIDLPGSHDNSSLRSLIEKPPICGSSFNPITGTMLTGFRLHAGPLPEQCRLMHIQPPKKKNKHKHKQSRTQDPVPP |
Length | 165 |
Position | Head |
Organism | Ornithorhynchus anatinus (Duckbill platypus) |
Kingdom | Metazoa |
Lineage | |
Aromaticity | 0.05 |
Grand average of hydropathy | -0.775 |
Instability index | 60.07 |
Isoelectric point | 9.75 |
Molecular weight | 17892.37 |
Publications |
Annotated function |
|
GO - Cellular Component | |
GO - Biological Function | |
GO - Biological Process |
Binary Interactions |
Repeats | >MDP27301 No repeats found |
MoRF Sequence | Start | Stop |
1) LYVIR 2) QILDYFSGR 3) TIIADYYVI | 80 30 95 | 84 38 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab