| Description | Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSSVVNEKVNHLDISWNDPALLNPLPNKEQILDYFSGRSNPFYDRTCNNETIKMQRLSLAHLENMVGVEYILLHEQEPILYVIRKQRRHSPNQVTIIADYYVIAGTVYQAPDLASVCNSRLVSS |
| Length | 124 |
| Position | Head |
| Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia> Cionidae> Ciona. |
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.288 |
| Instability index | 52.54 |
| Isoelectric point | 6.04 |
| Molecular weight | 14233.03 |
| Publications | PubMed=12481130 PubMed=15114417 |
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
ECO:0000256 RuleBase:RU364143 |
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central mediator complex GO:0016592 IBA:GO_Central |
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central |
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central |
| Binary Interactions |
| Repeats |
>MDP27300
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.77| 12| 18| 81| 92| 1
---------------------------------------------------------------------------
81- 92 (22.31/17.86) YVIRKQRRHSPN
101- 112 (21.46/16.94) YVIAGTVYQAPD
---------------------------------------------------------------------------
|
| MoRF Sequence | Start | Stop |
| 1) LYVIR 2) QILDYFSGR 3) TIIADYYVI | 80 30 95 | 84 38 103 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab