<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27300
| Description |
Mediator of RNA polymerase II transcription subunit 6 |
| Sequence | MSSVVNEKVNHLDISWNDPALLNPLPNKEQILDYFSGRSNPFYDRTCNNETIKMQRLSLAHLENMVGVEYILLHEQEPILYVIRKQRRHSPNQVTIIADYYVIAGTVYQAPDLASVCNSRLVSS |
| Length | 124 |
| Position | Head |
| Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
| Aromaticity | 0.08 |
| Grand average of hydropathy | -0.288 |
| Instability index | 52.54 |
| Isoelectric point | 6.04 |
| Molecular weight | 14233.03 |
| Publications | PubMed=12481130
PubMed=15114417
|
Function
| Annotated function |
Component of the Mediator complex, a coactivator involved in
the regulated transcription of nearly all RNA polymerase II-dependent
genes. Mediator functions as a bridge to convey information from gene-
specific regulatory proteins to the basal RNA polymerase II
transcription machinery. Mediator is recruited to promoters by direct
interactions with regulatory proteins and serves as a scaffold for the
assembly of a functional preinitiation complex with RNA polymerase II
and the general transcription factors.
|
| GO - Cellular Component | core mediator complex GO:0070847 IBA:GO_Central
mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coactivator activity GO:0003713 IBA:GO_Central
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IBA:GO_Central
|
Interaction
Repeat regions
| Repeats |
>MDP27300
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length |Diagonal| BW-From| BW-To| Level
2| 43.77| 12| 18| 81| 92| 1
---------------------------------------------------------------------------
81- 92 (22.31/17.86) YVIRKQRRHSPN
101- 112 (21.46/16.94) YVIAGTVYQAPD
---------------------------------------------------------------------------
|