<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27290
| Description |
Mediator complex subunit 16 |
| Sequence | MCDLRRPAAGGMMDLAYVCEWEKWSKSTHCPSVPLACAWSCRNLIAFTMDLRSDDQGALVLKTWSWRITGLFCSGAAGGGGTACSLSCRPG |
| Length | 91 |
| Position | Tail |
| Organism | Callithrix jacchus (White-tufted-ear marmoset) |
| Kingdom | Metazoa |
| Lineage | |
| Aromaticity | 0.09 |
| Grand average of hydropathy | 0.074 |
| Instability index | 55.38 |
| Isoelectric point | 8.16 |
| Molecular weight | 9792.27 |
| Publications | |
Function
| Annotated function |
|
| GO - Cellular Component | |
| GO - Biological Function | |
| GO - Biological Process | |
Interaction
Repeat regions
| Repeats |
>MDP27290
No repeats found
|