<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27288
| Description |
Uncharacterized protein |
| Sequence | QRQALSHTIQNQLNSYNKRLKDDIRSMLDNFCEIIKSGKVDENQQLDRATQNYYDVYQMRVRSANIVRAGESLLRLIAELKTFLILNDFPSINRHIEAQNNHLNLVSGKWNEQLVRLRDEASVVLHDLESELYSSIRP |
| Length | 138 |
| Position | Head |
| Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
| Kingdom | Metazoa |
| Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia>
Cionidae> Ciona.
|
| Aromaticity | 0.07 |
| Grand average of hydropathy | -0.601 |
| Instability index | 43.86 |
| Isoelectric point | 7.10 |
| Molecular weight | 16154.03 |
| Publications | PubMed=12481130
PubMed=15114417
|
Function
| Annotated function |
|
| GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central
|
| GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro
|
| GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro
|
Interaction
Repeat regions
| Repeats |
>MDP27288
No repeats found
No repeats found
|