Description | Uncharacterized protein |
Sequence | QRQALSHTIQNQLNSYNKRLKDDIRSMLDNFCEIIKSGKVDENQQLDRATQNYYDVYQMRVRSANIVRAGESLLRLIAELKTFLILNDFPSINRHIEAQNNHLNLVSGKWNEQLVRLRDEASVVLHDLESELYSSIRP |
Length | 138 |
Position | Head |
Organism | Ciona intestinalis (Transparent sea squirt) (Ascidia intestinalis) |
Kingdom | Metazoa |
Lineage | Eukaryota> Metazoa> Chordata> Tunicata> Ascidiacea> Phlebobranchia> Cionidae> Ciona. |
Aromaticity | 0.07 |
Grand average of hydropathy | -0.601 |
Instability index | 43.86 |
Isoelectric point | 7.10 |
Molecular weight | 16154.03 |
Publications | PubMed=12481130 PubMed=15114417 |
Annotated function |
|
GO - Cellular Component | mediator complex GO:0016592 IBA:GO_Central |
GO - Biological Function | transcription coregulator activity GO:0003712 IEA:InterPro |
GO - Biological Process | regulation of transcription by RNA polymerase II GO:0006357 IEA:InterPro |
Binary Interactions |
Repeats | >MDP27288 No repeats found No repeats found |
MoRF Sequence | Start | Stop |
1) NYYDVYQMRVR 2) YNKRLK | 52 16 | 62 21 |
© 2021 Shailesh Lab
Designed by Dr. Shailesh Lab & Dr. Jitendra K. Thakur Lab