<p>This section provides information about the protein and gene name(s) and synonym(s) and about the organism that is the source of the protein sequence.<p><a href='/help/names_and_taxonomy_section' target='_top'>More...</a></p>Detailed information on MDP27282

Description Mediator complex subunit 14
SequenceMAPVQLESHQLVPPGGGGSGGGPASAPAPPPPGAAVAAAAAAAASPGYRLSTLIEFLLHRAYAELMVLTDLLPRKSDVERKIEIVQFASRTRQLFVRLLALVKWANNAGKVEKCAMISSFLDQQAILFVDTADRLASLARDALVHARLPSFAIPYAIDVLTTGSYPRLPTCIRDKIIPPDPITKTEKQTTLHQLNQILRHRLVTTDLPPQLANLTVANGRVKFRVEGEFEATLTVMGDDPDVPWRLLKLEILVEDKETGDGRALVHSMQISFIHQLVQSRLFADEKPLQDMYNCLHSFCLSLQLEVLHSQTLMLIRERWGDLVQVEKYHAGKCLSLTVWNQQVLGRKTGIASVHKVTIKIDESDVSKPLQIFHDPPLPASDSKLVERAMKIDHLSIEKLLIDSVHARSHQKLQELKSILKGFNANENSFIETALPTLVIPILEPCGRSECLHIFVDLHSGMFQLMLYGLDQATLDDIEKSVNDDMKRIIPWIQQLKFWLGQQRCKQSIKHLPIMCSETLQLSNYSTHPVGNLSKNKLFIKLTRLPQYYIVVEMFEVPSNPTELEYKYHFLSVSSAEGDESPATALLLQQFKTNIEERLLDPKAGKVRAGVKRKLSGDPNPEEPKKPKRSEEMCAFNKVLAHFVAVCDTNMPFIGLRMELCNMEIPHQGVQVEGDGFSHAIRLLKIPPCKGTSEETQKALDRALLDCTFRLQGRNNRTWVAELVFANCPLSSTSTREQGPTRHVYLTYENLLSEPVGGRKVVEMFLNDWNSIARLYECVLEFARSLPDIPAHLNIFSEVRVYNYRKLILCYGTTKGSSISIQWNSSHQKFNISLGTVGPNSGCSNCHNTILHQLQEMFNKTPNVVQLLQVLFDTQAPLNAINKLPTVPMLGLTQRTNTAYQCFSILPQSSTHIRLAFRNMYCIDIYCRSRGVVAIRDGAYSLFDNSKIVEGFYPAPGLKTFLNMFVDSNQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPQVPPQQQPFPKQPGPSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTIDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRMPGMSPANPSLHSPIPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWAASIPTILTHSALNILLLPSPTPGLVPGLAGSYLCSPLERFLGSVIMRRHLQRIIQQETLQLINSNEPGVIMFKTDALKCRVALSPKTNQTLQLKVTPENAGQWKPDELQVLEKFFETRVAGPPFKANTLIAFTKLLGAPTHILRDCVHIMKLELFPDQATQLKWNVQFCLTIPPSAPPIAPPGTPAVVLKSKMLFFLQLTQKTSVPPQEPVSIIVPIIYDMASGTTQQADIPRQQNSSVAAPMMVSNILKRFAEMNPPRQGECTIFPAVRDLMANLTLPPGGRP
Length1454
PositionTail
OrganismMonodelphis domestica (Gray short-tailed opossum)
KingdomMetazoa
LineageEukaryota> Metazoa> Chordata> Craniata> Vertebrata> Euteleostomi> Mammalia> Metatheria> Didelphimorphia> Didelphidae> Monodelphis.
Aromaticity0.07
Grand average of hydropathy-0.183
Instability index53.45
Isoelectric point8.79
Molecular weight160573.65
Publications
PubMed=17495919

Function

Annotated function Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene- specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors. 
GO - Cellular Component
core mediator complex	GO:0070847	IBA:GO_Central
mediator complex	GO:0016592	IBA:GO_Central

GO - Biological Function
transcription coactivator activity	GO:0003713	IEA:Ensembl
transcription coregulator activity	GO:0003712	IBA:GO_Central

GO - Biological Process
positive regulation of transcription initiation from RNA polymerase II promoter	GO:0060261	IEA:Ensembl
regulation of transcription by RNA polymerase II	GO:0006357	IBA:GO_Central
stem cell population maintenance	GO:0019827	IEA:Ensembl









Interaction





Binary Interactions











Repeat regions





Repeats

>MDP27282
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             6|     225.99|      32|      32|    1036|    1067|       1
---------------------------------------------------------------------------
   11-   25 (28.46/ 7.90)	L...VP..................PGG.............GGSG......GGPA.S
 1000- 1027 (35.81/11.88)	........................PQVPPQQQP..FPKQPGPSGAypLTSP.PT.S
 1028- 1064 (49.40/19.26)	YhstVN................qsPSMMHTQSPGNLHAASSPSGA..LRAPSPA.S
 1065- 1098 (44.32/16.50)	F...VP................tpPPSSHGISIGPGASFASPHGT..IDPSSPY.T
 1099- 1125 (41.10/14.75)	M...VS..................PSGRAGNWPGS.PQVSGPSPA..TRMP.....
 1153- 1201 (26.91/ 7.05)	T...MPtnmppprklpqrswaasiPTIL.THSALNILLLPSPTPG..L.VPGLAgS
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      74.06|      24|      24|    1363|    1386|       2
---------------------------------------------------------------------------
 1362- 1385 (39.65/18.30)	KMLFFL..QLTQKTSVPPQEPVSIIV
 1386- 1411 (34.41/14.91)	PIIYDMasGTTQQADIPRQQNSSVAA
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      94.28|      30|      31|     245|     274|       3
---------------------------------------------------------------------------
  245-  274 (48.53/35.09)	RLLKLEILVEDKETGDGRALVH....SMQISFIH
  275-  308 (45.74/32.61)	QLVQSRLFADEKPLQDMYNCLHsfclSLQLEVLH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             3|      61.92|      14|      29|     167|     180|       4
---------------------------------------------------------------------------
  134-  150 (17.29/ 7.95)	RLASLARDALV....HarlPS
  167-  180 (25.87/16.30)	RLPTCIRDKII....P...PD
  193-  210 (18.77/ 9.39)	QLNQILRHRLVttdlP...PQ
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      31.31|       9|      24|     631|     641|       5
---------------------------------------------------------------------------
  631-  641 (12.67/13.52)	EMCafNKVLAH
  658-  666 (18.64/10.90)	ELC..NMEIPH
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      63.24|      20|     212|     515|     554|       6
---------------------------------------------------------------------------
  519-  554 (26.79/50.77)	LQLSNYSTHPVGNLSknklfikltrlpqyyiVVEMF
  745-  764 (36.45/16.27)	LTYENLLSEPVGGRK................VVEMF
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      43.60|      14|      36|    1247|    1261|       8
---------------------------------------------------------------------------
 1247- 1261 (21.47/18.17)	LKCRVALSP.KTNqTL
 1285- 1299 (22.14/12.84)	FETRVAGPPfKAN.TL
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|      35.75|      11|      25|     765|     776|      10
---------------------------------------------------------------------------
  765-  776 (16.58/16.37)	LNDWNSIaRLYE
  792-  802 (19.17/12.83)	LNIFSEV.RVYN
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     142.24|      47|     507|     331|     378|      13
---------------------------------------------------------------------------
  331-  378 (79.31/67.98)	GKCLSLTvWN...QQ......VLGRKTGIASVHKVTI.KIDE.....SDVSKPLQIFHDPPLP
  815-  876 (62.93/47.69)	GSSISIQ.WNsshQKfnislgTVGPNSGCSNCHNTILhQLQEmfnktPNVVQLLQVLFDTQAP
---------------------------------------------------------------------------
---------------------------------------------------------------------------
No. of Repeats|Total Score|Length  |Diagonal| BW-From|   BW-To|   Level
             2|     104.27|      32|      36|      62|      96|      18
---------------------------------------------------------------------------
   65-   96 (51.36/46.55)	LMVLTDLLPRKSDVERKIEIVQFASRTRQLFV
   98-  129 (52.92/37.51)	LLALVKWANNAGKVEKCAMISSFLDQQAILFV
---------------------------------------------------------------------------




































Explaination for Stockholm format
  The  "Stockholm" format is a system for marking up features in a multiple alignment. These mark-up annotations are preceded by a 'magic' label, of which there are four types. The Stockholm format is used by HMMER, Pfam, and Belvu. Mark-up lines include any characters except whitespace. Underscore ("_") is used instead of space. 

 #=GR (seqname) PP (Generic per-Sequence AND per-Column markup, exactly 1 char per column) where PP is Posterior Probability  [0-9*], (0=0.00-0.05; 1=0.05-0.15; *=0.95-1.00) 
 
 #=GC PP_cons line is Stockholm-format consensus posterior probability annotation for the entire column.  It’s calculated simply as the arithmetic mean of the per-residue posterior probabilities in that column.  This should prove useful in phylogenetic inference applications, for example, where it’s common to mask away non confidently aligned columns of a multiple alignment. The PP_cons line provides an objective measure of the confidence assigned to each column.
 
 #=GC RF line is Stockholm-format reference coordinate annotation, with an x marking each column that the profile considered to be consensus.





Alignment of MDP27282 with Med14 domain of Kingdom Metazoa


     
       
      
        
        
        


      
      
   
   

      

      














Intrinsically Disordered Regions








IDR SequenceStartStop




1) NQDARRRSVNEDDNPPSPIGGDMMDSLISQLQPQVPPQQQPFPKQPGPSGAYPLTSPPTSYHSTVNQSPSMMHTQSPGNLHAASSPSGALRAPSPASFVPTPPPSSHGISIGPGASFASPHGTIDPSSPYTMVSPSGRAGNWPGSPQVSGPSPATRMPGMSPANPSLHSPIPDASHSPRAGTSSQTMPTNMPPPRKLPQRSWA
968
1170










Molecular Recognition Features






MoRF SequenceStartStop




NANANA